Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Aquaporin-3 (Aqp3)

This Recombinant Rat Aquaporin-3 (Aqp3) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Aquaporin-3, AQP-3, 31.4 kDa water channel protein, Aquaglyceroporin-3

UniProt

P47862

Expression Region

1-292

Origin

Rattus norvegicus (Rat)

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTIN LAFGFAVTLAILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVF GLYYDAIWAFAGNELVVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVD PYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGQ NWWWVPIVSPLLGSIGGVFVYQLMIGCHLEQPPPSTEAENVKLAHMKHKEQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-500 1x 500 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-100 1x 100 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-100 1x 100 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
BNC740177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF740 conjugate, 0.1mg/mL
BNC740955-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details