Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidovorax citrulli ATP synthase subunit a (atpB)

This Recombinant Acidovorax citrulli ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1TJ35

Expression Region

1-292

Origin

Acidovorax citrulli (strain AAC00-1) (Acidovorax avenae subsp. citrulli)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAEAHAPTASEYIVHHLQHLQNIKQKSIVDFSVVNIDSVVVGLVLGAIALFAFWLCARK ATSGVPGRFQAAVEILVEMVDNQAKANIHNAESRKFIAPLALTVFVWIFLMNAMDMLPVD LLPAIWAQIYGAAGHDPHHAYLRVVPTADLSTTLGLSTAVLVLCLYYSVKIKGLGGWAHE LVTAPFGTSKNPVFALILGVVNLLMQIIEYVAKTVSHGMRLFGNMYAGELVFMLIALMGG AAAMSLSGVLLPVGHIIAGSIWAIFHILVITLQAFIFMMLALIYLGQAHEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-100 1x 100 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-100 1x 100 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
BNC880352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF405S conjugate, 0.1mg/mL
BNC042616-100 1x 100 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details