Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidaminococcus fermentans Protein translocase subunit SecF (secF)

This Recombinant Acidaminococcus fermentans Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

D2RLC7

Expression Region

1-293

Origin

Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / VR4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKFSIVKHARIFFSITAVVLIVGIVSMFARGFNLGIDFTGGSILDIKFDQPVTVAQVRT VLSDHQLGSSVIQLGSSDQQVESSQSVLIRTGLISDSQRVDVMNDLSNRLGHNEVLRVEN VGATVGGDLVKSAVGAVVLSWVLMIIYITIRFELRFALAAIVALIIDVMVTLTWFSVLHL EIDSSFVAALLTVVGYSVNGTIVVFDRIRENLHTHRRNESMGDLVDASIWQTMTRSVYTT LTTLFAVVAIFLFGGETIHNFSFAMLVGFCSGFYTSTFLAGSMWLFFRKKLKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin Conjugated Vicia villosa Lectin (Hairy Vetch) -VVA-
I-4601-1 1 mg

Ferritin Conjugated Vicia villosa Lectin (Hairy Vetch) -VVA-

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (rCFTR/1342), CF594 conjugate, 0.1mg/mL
BNC942291-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (rCFTR/1342), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKR1A1 (NM_006066) Human Over-expression Lysate
LY401826 100 µg

AKR1A1 (NM_006066) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Propylphosphorothioic Triamide
TRC-P833705-1G 1 g

N-Propylphosphorothioic Triamide

Sign In for Pricing
View Details
PTMS (C-term) Rabbit Polyclonal Antibody
AP53505PU-N 400 µL

PTMS (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C14orf177 (NM_182560) Human Recombinant Protein
TP310785L 1 mg

C14orf177 (NM_182560) Human Recombinant Protein

Sign In for Pricing
View Details