Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidaminococcus fermentans Protein translocase subunit SecF (secF)

This Recombinant Acidaminococcus fermentans Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

D2RLC7

Expression Region

1-293

Origin

Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / VR4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKFSIVKHARIFFSITAVVLIVGIVSMFARGFNLGIDFTGGSILDIKFDQPVTVAQVRT VLSDHQLGSSVIQLGSSDQQVESSQSVLIRTGLISDSQRVDVMNDLSNRLGHNEVLRVEN VGATVGGDLVKSAVGAVVLSWVLMIIYITIRFELRFALAAIVALIIDVMVTLTWFSVLHL EIDSSFVAALLTVVGYSVNGTIVVFDRIRENLHTHRRNESMGDLVDASIWQTMTRSVYTT LTTLFAVVAIFLFGGETIHNFSFAMLVGFCSGFYTSTFLAGSMWLFFRKKLKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Endometriotic tissue
CR560823 5 µg

Tissue Total RNA, Endometriotic tissue

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (DO-1), CF488A conjugate, 0.1mg/mL
BNC881658-500 1x 500 µL

P53 Tumor Suppressor Protein (DO-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MIR4454 Human qPCR Primer Pair (MI0016800)
HP300970 200 Reactions

MIR4454 Human qPCR Primer Pair (MI0016800)

Sign In for Pricing
View Details
K252A
SIH-455-100UG 100 µg

K252A

Sign In for Pricing
View Details
Pregna-4,9(11)-diene-3,20-dione (90%)
TRC-P704970-10MG 10 mg

Pregna-4,9(11)-diene-3,20-dione (90%)

Sign In for Pricing
View Details
DNAJB5 (NM_001135004) Human Over-expression Lysate
LY427521 100 µg

DNAJB5 (NM_001135004) Human Over-expression Lysate

Sign In for Pricing
View Details