Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidaminococcus fermentans Protein translocase subunit SecF (secF)

This Recombinant Acidaminococcus fermentans Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

D2RLC7

Expression Region

1-293

Origin

Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / VR4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKFSIVKHARIFFSITAVVLIVGIVSMFARGFNLGIDFTGGSILDIKFDQPVTVAQVRT VLSDHQLGSSVIQLGSSDQQVESSQSVLIRTGLISDSQRVDVMNDLSNRLGHNEVLRVEN VGATVGGDLVKSAVGAVVLSWVLMIIYITIRFELRFALAAIVALIIDVMVTLTWFSVLHL EIDSSFVAALLTVVGYSVNGTIVVFDRIRENLHTHRRNESMGDLVDASIWQTMTRSVYTT LTTLFAVVAIFLFGGETIHNFSFAMLVGFCSGFYTSTFLAGSMWLFFRKKLKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenetrazine Hydrochloride
TRC-P296330-10MG 10 mg

Phenetrazine Hydrochloride

Sign In for Pricing
View Details
IL3RA (NM_002183) Human Over-expression Lysate
LC419481 20 µg

IL3RA (NM_002183) Human Over-expression Lysate

Sign In for Pricing
View Details
ARHGAP8 (NM_001017526) Human Over-expression Lysate
LY422740 100 µg

ARHGAP8 (NM_001017526) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR560507 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Human ETDB activation kit by CRISPRa
GA119099 1 Kit

Human ETDB activation kit by CRISPRa

Sign In for Pricing
View Details
PPP6C Rabbit Monoclonal Antibody
TA424327 100 µL

PPP6C Rabbit Monoclonal Antibody

Sign In for Pricing
View Details