Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bordetella avium ATP synthase subunit a (atpB)

This Recombinant Bordetella avium ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q2KU30

Expression Region

1-293

Origin

Bordetella avium (strain 197N)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAASGASPQSEYIQHHLVHLNNLGEKQSVIAQFNVINYDSLFWSGLMGLIVIFCLWLAA RRATAGVPGRFQGFVEMIVDMVNDQAKGIVQNAKSREFVAPLALTVFLWIILMNALDLLP VDLFPTIWRVTGLGAEHGDPLYYHRILPTADLNVPMGMSLGVLLLMFYYGIKIKHPAGFV KELFTAPFHAHGLAALVLAPFNLLLNLIEYAAKSVSLGMRLFGNMFAGELIFMLIALLGG AWTGFNASSIGLGIGHVLAGSVWAIFHILIVLLQAFIFMMLTLVYIGQAHEGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIK (NM_001197) Human Recombinant Protein
TP760492 50 µg

BIK (NM_001197) Human Recombinant Protein

Sign In for Pricing
View Details
Pop7 (NM_028753) Mouse Tagged ORF Clone
MG200880 10 µg

Pop7 (NM_028753) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Metalloproteinase Inhibitor 2 Antibody
RC-15553-01 50 μL

Recombinant Metalloproteinase Inhibitor 2 Antibody

Sign In for Pricing
View Details
Recombinant Metalloproteinase Inhibitor 2 Antibody
RC-15553-02 100 µL

Recombinant Metalloproteinase Inhibitor 2 Antibody

Sign In for Pricing
View Details
Recombinant Metalloproteinase Inhibitor 2 Antibody
RC-15553-03 1 mL

Recombinant Metalloproteinase Inhibitor 2 Antibody

Sign In for Pricing
View Details
ARFGAP3 Antibody
OC-206-01 50 μL

ARFGAP3 Antibody

Sign In for Pricing
View Details