Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bordetella avium ATP synthase subunit a (atpB)

This Recombinant Bordetella avium ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q2KU30

Expression Region

1-293

Origin

Bordetella avium (strain 197N)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAASGASPQSEYIQHHLVHLNNLGEKQSVIAQFNVINYDSLFWSGLMGLIVIFCLWLAA RRATAGVPGRFQGFVEMIVDMVNDQAKGIVQNAKSREFVAPLALTVFLWIILMNALDLLP VDLFPTIWRVTGLGAEHGDPLYYHRILPTADLNVPMGMSLGVLLLMFYYGIKIKHPAGFV KELFTAPFHAHGLAALVLAPFNLLLNLIEYAAKSVSLGMRLFGNMFAGELIFMLIALLGG AWTGFNASSIGLGIGHVLAGSVWAIFHILIVLLQAFIFMMLTLVYIGQAHEGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (4-Methyl-1,3-thiazol-2-yl) aniline
PBA71992-01 250 mg

4- (4-Methyl-1,3-thiazol-2-yl) aniline

Sign In for Pricing
View Details
4- (4-Methyl-1,3-thiazol-2-yl) aniline
PBA71992-02 2.5 g

4- (4-Methyl-1,3-thiazol-2-yl) aniline

Sign In for Pricing
View Details
EIF4EBP1 (Eukaryotic Translation Initiation Factor 4E-binding Protein 1, 4E-BP1, eIF4E-binding Protein 1, Phosphorylated Heat- and Acid-stable Protein Regulated by Insulin 1, PHAS-I)
140176 200 µL

EIF4EBP1 (Eukaryotic Translation Initiation Factor 4E-binding Protein 1, 4E-BP1, eIF4E-binding Protein 1, Phosphorylated Heat- and Acid-stable Protein Regulated by Insulin 1, PHAS-I)

Sign In for Pricing
View Details
NHEJ1, CT (NHEJ1, XLF, Non-homologous end-joining factor 1, Protein cernunnos, XRCC4-like factor) (MaxLight 650) discontinued
038960-ML650 100 µL

NHEJ1, CT (NHEJ1, XLF, Non-homologous end-joining factor 1, Protein cernunnos, XRCC4-like factor) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Lentiviral human TMSB15B shRNA (UAS) - Lentiviral human TMSB15B shRNA (UAS) (25)
GTR15283541 1 Vial

Lentiviral human TMSB15B shRNA (UAS) - Lentiviral human TMSB15B shRNA (UAS) (25)

Sign In for Pricing
View Details
Lentiviral human CCDC57 shRNA (UAS) - Lentiviral human CCDC57 shRNA (UAS) plasmid
GTR15319138 1 Vial

Lentiviral human CCDC57 shRNA (UAS) - Lentiviral human CCDC57 shRNA (UAS) plasmid

Sign In for Pricing
View Details