Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus biovar 1 sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

This Recombinant Brucella abortus biovar 1 sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Sn-glycerol-3-phosphate transport system permease protein ugpA

UniProt

Q578E7

Expression Region

1-293

Origin

Brucella abortus biovar 1 (strain 9-941)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQKVTFPNKILPYFLLAPQIVLTVVFFFWPASQAIYQSFMREDAFGLKSTFVELANFTAV LSDPNYLHSVQVTVVFNVLTALLAMGVALLLATAADRVIRGQTFYRTLLIWPYAVAPAVA GMLWLFIFNPAMGTFAYLLRRNGIAWDPLLDGNQAMGLVVVAAAWKQISYNFLFFVAGLQ AIPKSLIEAAAIDGARGARRFWTIVFPLLAPTSFFLLVVNTVYAFFDTFGIIHAVTGGGP AKATETLVYKVYNDGFVNLNLGSSSAQSVILMAIVIALTAFQFRFVEKRVHYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
BNC470050-100 1x 100 µL

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-100 1x 100 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
BNC741003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details