Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bordetella bronchiseptica ATP synthase subunit a (atpB)

This Recombinant Bordetella bronchiseptica ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7WEM3

Expression Region

1-293

Origin

Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAPSGASPQSEYIQHHLVHLNNIGEKQSVIAQFNVINYDSLFWSILMGLLVVFCLWLAA RRATAGVPGRFQGFIEMIVDMVDDQAKSIVTNAKSRLFVAPLALTVFLWIILMNALDLLP VDLLPSIWRMTGLGAEHGDPLYYHRILPTADLNVPMGMSLGVLLLMFYYGIKIKHPGGFV KELFTAPFHAHGLASLVLAPFNLLLNLIEYAAKSVSLGMRLFGNMFAGELIFMLIALLGG AWTGFNGASIGLGIGHVLAGSVWAIFHILIVLLQAFIFMMLTLVYIGQAHEGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
BNC400965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-500 1x 500 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD137, Mouse (LOB12), CF488A conjugate, 0.1mg/mL
BNC882012-100 1x 100 µL

CD137, Mouse (LOB12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (CR1/802), CF640R conjugate, 0.1mg/mL
BNC400802-100 1x 100 µL

CD35 / CR1 (CR1/802), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details