Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Aquaporin-6 (Aqp6)

This Recombinant Mouse Aquaporin-6 (Aqp6) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Aquaporin-6, AQP-6

UniProt

Q8C4A0

Expression Region

1-293

Origin

Mus musculus (Mouse)

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPGLCSRAYLLVGGLWTAISKALFAEFLATGLYVFFGVGSVLPWPVALPSVLQIAITFN LATATAVQISWKTSGAHANPAVTLAYLVGSHISLPRAMAYIAAQLAGATAGAALLYGVTP GGIRETLGVNVVHNSTSTGQAVAVELVLTLQLVLCVFASMDGRQTLASPAAMIGTSVALG HLIGIYFTGCSMNPARSFGPAVIVGKFAVHWIFWVGPLTGAVLASLIYNFILFPDTKTVA QRLAILVGTTKVEKVVDLEPQKKESQTNSEDTECLTSPCEEAVRSFSFTLGLC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-100 1x 100 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-500 1x 500 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-500 1x 500 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/1783R), CF405S conjugate, 0.1mg/mL
BNC041783-500 1x 500 µL

CD45RB (B-Cell Marker) (PTPRC/1783R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details