Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium glutamicum Undecaprenyl-diphosphatase (uppP)

This Recombinant Corynebacterium glutamicum Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q8NQC3

Expression Region

1-293

Origin

Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEEITLLAAAADPAATENIGWVQTIVLSIVQGLTEFLPISSSGHLRIISELFWGADAGA SFTAVVQLGTEAAVLVFFAKEIWQIITGWFAGVFNKERRGFEYRMGWMIIVATIPVVILG VLGKDLIREALRNMWITASVLILFSLVFILAEKMGKKERDYDKLTMKDAIIMGLAQCLAL IPGVSRSGGTISAGLFLGLKREVATKFSFLLAIPAVLGSGLYSLPDAFAPSSGQAASGLQ LTVGTLVAFVVGYISIAWLMKFVANHSFSWFAAYRIPAGLLVMLLLALGMLNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epstein-Barr Virus (LMP-1) (CS4), CF594 conjugate, 0.1mg/mL
BNC941744-500 1x 500 µL

Epstein-Barr Virus (LMP-1) (CS4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FGFR1 (NM_023110) Human Over-expression Lysate
LC402963 20 µg

FGFR1 (NM_023110) Human Over-expression Lysate

Sign In for Pricing
View Details
TTL Polyclonal Antibody
E-AB-90040-01 60 µL

TTL Polyclonal Antibody

Sign In for Pricing
View Details
TTL Polyclonal Antibody
E-AB-90040-02 120 µL

TTL Polyclonal Antibody

Sign In for Pricing
View Details
TTL Polyclonal Antibody
E-AB-90040-03 200 µL

TTL Polyclonal Antibody

Sign In for Pricing
View Details
HAGH Antibody
KC-1962-01 50 μL

HAGH Antibody

Sign In for Pricing
View Details