Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bordetella petrii ATP synthase subunit a (atpB)

This Recombinant Bordetella petrii ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A9HY34

Expression Region

1-293

Origin

Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAASDVSPQSAYIQHHLVHLNNIGEKQSVIAQFNVINYDSVFWSALTGLVVVLFLWLAA RRASAGVPGRFQAFVEMIVDMVDEQAKGIVTNAKSRLFVAPLALTVFLWIILMNALDLIP VDLMPTVWRWTGLGAHHGDPLYYHRILPTADLNVPMGMSLGVLLLMFYYGIKIKHPGGFV KELFTAPFHAHGIAALFLAPANLLLNLIEYAAKSVSLGMRLFGNMFAGELVFMLIALLGG AWTGLNAASVGLGIGHVLAGSVWAIFHILIVLLQAFIFMMLTLVYIGQAHEGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-100 1x 100 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
BNC941231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
BNC940304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
BNC940177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details