Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. lactis Oligopeptide transport system permease protein oppC (oppC)

This Recombinant Lactococcus lactis subsp. lactis Oligopeptide transport system permease protein oppC (oppC) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Oligopeptide transport system permease protein oppC

UniProt

P0A4N9

Expression Region

1-294

Origin

Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEKKHKNSLSLVHSIKEELKKDKLAMISTIFLVAVFLIVYIYSMFLKQSNYVDVNIMDQ YLAPLTNGHLLGTDNGGRDIIMMLMISARNSFNIAFAVTLITLVVGNILGVITGYFGGRF DLIFMRFTDFVMILPSMMIIIVFVTIIPRFNSWSLIGIISIFSWIGTTRLIRARTMTEVN RDYVRASKTSGTSDFKIMFREIWPNLSTLVIAEATLVFAGNIGLETGLSFLGFGLPAGTP SLGTMINEATNPETMTDKPWTWVPATVVILIVVLAIIFIGNALRRVADQRQATR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat GM-CSF Protein (His Tag)
PDMR100057-01 20 µg

Recombinant Rat GM-CSF Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat GM-CSF Protein (His Tag)
PDMR100057-02 100 µg

Recombinant Rat GM-CSF Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat GM-CSF Protein (His Tag)
PDMR100057-03 500 µg

Recombinant Rat GM-CSF Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat GM-CSF Protein (His Tag)
PDMR100057-04 1 mg

Recombinant Rat GM-CSF Protein (His Tag)

Sign In for Pricing
View Details
Hsp22 (HSPB8) Human Knockdown Lysate
LY300011 100 µg

Hsp22 (HSPB8) Human Knockdown Lysate

Sign In for Pricing
View Details
GW 501516
TRC-G931500-5MG 5 mg

GW 501516

Sign In for Pricing
View Details