Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

This Recombinant sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Sn-glycerol-3-phosphate transport system permease protein ugpA

UniProt

Q66FU6

Expression Region

1-294

Origin

Yersinia pseudotuberculosis

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPSRPGFSCSWLPYLLVLPQLAITAIFFLWPAGEALWYSVQTLDPFGLSSEFVGLSNFI QLFQDEYYLASFYTTLIFSALVAGIGLNVSLFLAAMVDYVLRGSRLYQTLLILPYAVAPA VAAVLWIFLFDPGLGLITHALAKLGYSWNHAQNSGQAMFLVVLASVWKQISYNFLFFLAA LQSIPKSLVEAAAIDGAGPVRRFFNLVLPLISPVSFFLLVVNLVYAFFDTFPVIDAATGG GPVQATTTLIYKIYREGFAGLDLSSSAAQSVILMLLVIGLTVIQFRFVERKVRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-500 1x 500 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF740 conjugate, 0.1mg/mL
BNC740342-500 1x 500 µL

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
BNC940009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-100 1x 100 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/486), CF405S conjugate, 0.1mg/mL
BNC040486-100 1x 100 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/486), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details