Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Aquaporin NIP2-2 (NIP2-2)

This Recombinant Zea mays Aquaporin NIP2-2 (NIP2-2) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Aquaporin NIP2-2, NOD26-like intrinsic protein 2-2, ZmNIP2-2, ZmNIP2;2

UniProt

Q9ATN2

Expression Region

1-294

Origin

Zea mays (Maize)

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAASTTSRTNSRVNYSNEIHDLSTVQSGSVVPTLFYPDKSIADIFPPHLGKKVISEVVA TFLLVFVTCGAASIYGEDNRRISQLGQSVAGGLIVTVMIYATGHISGAHMNPAVTLSFAC FRHFPWIQVPFYWAAQFTGAMCAAFVLKAVLHPIAVIGTTTPSGPHWHALLIEIVVTFNM MFVTCAVATDSRAVGELAGLAVGSAVCITSIFAGPVSGGSMNPARTLAPAVASNVFTGLW IYFLGPVIGTLSGAWVYTYIRFEEAPAAKDTQRLSSFKLRRMQSQLAADEFDTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-500 1x 500 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
BNC400096-500 1x 500 µL

Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
BNC881045-500 1x 500 µL

CD16 (C16/1045), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-100 1x 100 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (C81/2885R), CF647 conjugate, 0.1mg/mL
BNC472885-500 1x 500 µL

CD81 / TAPA-1 (C81/2885R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), Biotin conjugate, 0.1mg/mL
BNCB0460-100 1x 100 µL

CD44 Standard (156-3C11), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details