Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphate transport system permease protein pstA (pstA)

This Recombinant Phosphate transport system permease protein pstA (pstA) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstA

UniProt

P58655

Expression Region

1-295

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVTIDMRNDATLMESRRKKQAWRRQKNRIALVLSMATMLFGLFWLIWILFSTVTKGIDGM SLALFTEMTPPPNTAGGGLANAIAGSGLLILWATVIGTPLGIMAGIYLAEYGRKSWLAEV TRFINDILLSAPSIVVGLFVYTIVVAKMEHFSGWAGVIALALLQVPIVIRTTENMLKLVP DSLREAAYALGTPKWRMISAITLKASVSGILTGILLAIARIAGETAPLLFTSLSNQFWST DLTRPIANLPVTIFKFAMSPFAEWQNLAWAGVLLITLCVLLLNILARVIFAKKKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT1 Rabbit Polyclonal Antibody (Biotin)
orb444985 100 µL

STAT1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Anti-SMARCA5 Rabbit Monoclonal Antibody
MA5163-.1 100 µL

Anti-SMARCA5 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Fhod1 shRNA (UAS) - Lentiviral mouse Fhod1 shRNA (UAS) (25)
GTR15236561 1 Vial

Lentiviral mouse Fhod1 shRNA (UAS) - Lentiviral mouse Fhod1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Recombinant Micrococcus luteus Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)
MBS1150907-01 0.05 mg (E-Coli)

Recombinant Micrococcus luteus Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)

Sign In for Pricing
View Details
Recombinant Micrococcus luteus Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)
MBS1150907-02 0.05 mg (Yeast)

Recombinant Micrococcus luteus Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)

Sign In for Pricing
View Details
Recombinant Micrococcus luteus Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)
MBS1150907-03 0.05 mg (Baculovirus)

Recombinant Micrococcus luteus Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)

Sign In for Pricing
View Details