Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphate transport system permease protein pstA (pstA)

This Recombinant Phosphate transport system permease protein pstA (pstA) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstA

UniProt

P58655

Expression Region

1-295

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVTIDMRNDATLMESRRKKQAWRRQKNRIALVLSMATMLFGLFWLIWILFSTVTKGIDGM SLALFTEMTPPPNTAGGGLANAIAGSGLLILWATVIGTPLGIMAGIYLAEYGRKSWLAEV TRFINDILLSAPSIVVGLFVYTIVVAKMEHFSGWAGVIALALLQVPIVIRTTENMLKLVP DSLREAAYALGTPKWRMISAITLKASVSGILTGILLAIARIAGETAPLLFTSLSNQFWST DLTRPIANLPVTIFKFAMSPFAEWQNLAWAGVLLITLCVLLLNILARVIFAKKKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KPNA4 Rabbit pAb
E45R24554N 50 ul

KPNA4 Rabbit pAb

Sign In for Pricing
View Details
RSH3 Antibody
orb842082 2 mg

RSH3 Antibody

Sign In for Pricing
View Details
Sheep Olfactory receptor 10A7 (OR10A7) ELISA Kit
MBS7248298-01 48 Well

Sheep Olfactory receptor 10A7 (OR10A7) ELISA Kit

Sign In for Pricing
View Details
Sheep Olfactory receptor 10A7 (OR10A7) ELISA Kit
MBS7248298-02 96 Well

Sheep Olfactory receptor 10A7 (OR10A7) ELISA Kit

Sign In for Pricing
View Details
Sheep Olfactory receptor 10A7 (OR10A7) ELISA Kit
MBS7248298-03 5x 96 Well

Sheep Olfactory receptor 10A7 (OR10A7) ELISA Kit

Sign In for Pricing
View Details
Sheep Olfactory receptor 10A7 (OR10A7) ELISA Kit
MBS7248298-04 10x 96 Well

Sheep Olfactory receptor 10A7 (OR10A7) ELISA Kit

Sign In for Pricing
View Details