Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens Protein virB6 (virB6)

This Recombinant Agrobacterium tumefaciens Protein virB6 (virB6) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protein virB6

UniProt

P05356

Expression Region

1-295

Origin

Agrobacterium tumefaciens (strain 15955)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFTIPAPFTAIHTIFDVAFTTGLDSMLETIQEAVSAPLIACVTLWIIVQGILVIRGEVD TRSGITRVITVTIVVALIVGQANYQDYVVSIFEKTVPIFVQQFSVTGLPLQTVPAQLDTI FAVTQAVFQKIASEIGPMNDQDILAFQGAQWVLYGTLWSAFGVYDAVGILTKVLLAIGPL ILVGYIFDRTRDIAAKWIGQLITYGLLLLLLNLVATIVILTEATALTLMLGVITFAGTTA AKIIGLYELDMFFLTGDALIVALPAIAGNIGGSYWSGATQSASSLYRRFAQVERG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 Mouse Monoclonal Antibody [A1E5]
EM1901-41 100 µL

CD40 Mouse Monoclonal Antibody [A1E5]

Sign In for Pricing
View Details
EGLN2 (NM_053046) Human Over-expression Lysate
LC403281 20 µg

EGLN2 (NM_053046) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TET1 activation kit by CRISPRa
GA112913 1 Kit

Human TET1 activation kit by CRISPRa

Sign In for Pricing
View Details
Palladium (5% on Barium Sulfate)
TRC-P141050-5G 5 g

Palladium (5% on Barium Sulfate)

Sign In for Pricing
View Details
C10orf78 (SFR1) Rabbit Polyclonal Antibody
TA367893 100 µL

C10orf78 (SFR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZFYVE28 (Zinc Finger FYVE-type containing 28) (LST2/2426), CF405S conjugate, 0.1mg/mL
BNC042426-500 1x 500 µL

ZFYVE28 (Zinc Finger FYVE-type containing 28) (LST2/2426), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details