Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-53 (srg-53)

This Recombinant Serpentine receptor class gamma-53 (srg-53) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-53, Protein srg-53

UniProt

O16974

Expression Region

1-295

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLTKIWLCYGIFSAILMIFMIVLLSVSKHFTNSFYRVITMDIILNLLCWVNTWPSRMV FREDGFGFARFLYEFYNKSFDVSFFLSNVFFHVQSASTICICCHRLSTAIFDNSNRFWSR FYLLVYALIILYSFLAVQLLYRAPIKFDYELNKFYSEPATLDQRLSVAMYLRCFMSGYLL AIIIIALSTLYQVRKRIAPFDHLHKNLLRKMSLIAFSHTFVFTMLLAWQTLNSFVVYASF IELLMIVSDMISFSMAYILLIFDGNVRSVIKNNLPVIQINGRRISDAQRSQNNIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bak (BAK1) (N-term) Rabbit Polyclonal Antibody
AP22701PU-N 250 µL

Bak (BAK1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Stomach
CR563005 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details
MICB Mouse Monoclonal Antibody [Clone ID: OTI2H8]
CF813503 100 µg

MICB Mouse Monoclonal Antibody [Clone ID: OTI2H8]

Sign In for Pricing
View Details
c-Fos Recombinant Antibody [PSH05-77] - Guinea pig IgG2 (Chimeric)
HA601374 100 µL

c-Fos Recombinant Antibody [PSH05-77] - Guinea pig IgG2 (Chimeric)

Sign In for Pricing
View Details
BLNK (NM_001114094) Human Over-expression Lysate
LY426448 100 µg

BLNK (NM_001114094) Human Over-expression Lysate

Sign In for Pricing
View Details
AP2B1 Human Gene Knockout Kit (CRISPR)
KN401129 1 Kit

AP2B1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details