Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-53 (srg-53)

This Recombinant Serpentine receptor class gamma-53 (srg-53) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-53, Protein srg-53

UniProt

O16974

Expression Region

1-295

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLTKIWLCYGIFSAILMIFMIVLLSVSKHFTNSFYRVITMDIILNLLCWVNTWPSRMV FREDGFGFARFLYEFYNKSFDVSFFLSNVFFHVQSASTICICCHRLSTAIFDNSNRFWSR FYLLVYALIILYSFLAVQLLYRAPIKFDYELNKFYSEPATLDQRLSVAMYLRCFMSGYLL AIIIIALSTLYQVRKRIAPFDHLHKNLLRKMSLIAFSHTFVFTMLLAWQTLNSFVVYASF IELLMIVSDMISFSMAYILLIFDGNVRSVIKNNLPVIQINGRRISDAQRSQNNIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RYK (NM_002958) Human Over-expression Lysate
LY418988 100 µg

RYK (NM_002958) Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-p38 (T180) Rabbit Polyclonal Antibody
ER2001-51 100 µL

Phospho-p38 (T180) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS800389 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Alpaca IgG2b+2c, AlpHcAbs® Rabbit antibody (HRP)
HA710031 100 µg

Alpaca IgG2b+2c, AlpHcAbs® Rabbit antibody (HRP)

Sign In for Pricing
View Details
Gastrin (GAST/2634), CF405S conjugate, 0.1mg/mL
BNC042634-100 1x 100 µL

Gastrin (GAST/2634), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLS2 Polyclonal Antibody
E-AB-18003-01 20 µL

GLS2 Polyclonal Antibody

Sign In for Pricing
View Details