Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-53 (srg-53)

This Recombinant Serpentine receptor class gamma-53 (srg-53) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-53, Protein srg-53

UniProt

O16974

Expression Region

1-295

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLTKIWLCYGIFSAILMIFMIVLLSVSKHFTNSFYRVITMDIILNLLCWVNTWPSRMV FREDGFGFARFLYEFYNKSFDVSFFLSNVFFHVQSASTICICCHRLSTAIFDNSNRFWSR FYLLVYALIILYSFLAVQLLYRAPIKFDYELNKFYSEPATLDQRLSVAMYLRCFMSGYLL AIIIIALSTLYQVRKRIAPFDHLHKNLLRKMSLIAFSHTFVFTMLLAWQTLNSFVVYASF IELLMIVSDMISFSMAYILLIFDGNVRSVIKNNLPVIQINGRRISDAQRSQNNIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPTLC1 Antibody
KC-30516-01 50 μL

SPTLC1 Antibody

Sign In for Pricing
View Details
SPTLC1 Antibody
KC-30516-02 100 µL

SPTLC1 Antibody

Sign In for Pricing
View Details
SPTLC1 Antibody
KC-30516-03 1 mL

SPTLC1 Antibody

Sign In for Pricing
View Details
PAR6 (PARD6A) (NM_001037281) Human Over-expression Lysate
LY421938 100 µg

PAR6 (PARD6A) (NM_001037281) Human Over-expression Lysate

Sign In for Pricing
View Details
Ɑ-Butyric Acid NHS Ester-ω-Biotinamido PEG
135000-25-35.1G 1 g

Ɑ-Butyric Acid NHS Ester-ω-Biotinamido PEG

Sign In for Pricing
View Details
Acyclovir N,O-Diacetate
TRC-A167995-250MG 250 mg

Acyclovir N,O-Diacetate

Sign In for Pricing
View Details