Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

This Recombinant Salmonella paratyphi A sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Sn-glycerol-3-phosphate transport system permease protein ugpA

UniProt

Q5PJK9

Expression Region

1-295

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSFRPVFRSRWLPYLLVAPQLVITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLENFV ALFHDSYYLDAFWTTIKFSALVTFSGLLVSLFFAALVDYVVRGSRFYQTLMLLPYAVAPA VAAVLWIFLFNPGRGLITHFLGEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFFAA LQSIPRSLVEAAAIDGAGPIRRFFRLSLPLIAPVSFFLLVVNLVYAFFDTFPVIDAATAG GPVQATTTLIYKIYREGFTGLDLSASAAQSVVLMFLVIILTVVQFRYVESKVRYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-500 1x 500 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-500 1x 500 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
BNC470050-100 1x 100 µL

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-100 1x 100 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CC49), CF405S conjugate, 0.1mg/mL
BNC040732-100 1x 100 µL

TAG-72 / CA72.4 (CC49), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details