Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Aquaporin-9 (Aqp9)

This Recombinant Mouse Aquaporin-9 (Aqp9) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Aquaporin-9, AQP-9, Aquaglyceroporin-9

UniProt

Q9JJJ3

Expression Region

1-295

Origin

Mus musculus (Mouse)

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSEKDRAKKNLVQRLALKSCLAKETLSEFLGTFIMIVLGCGSIAQAVLSREKAGGIITI NIGFATAVVMALYATFGVSGGHINPAVSFAMCTFGRMEWFKFPFYVGAQLLGAFVGAATV FGIYYDGLMAFADGKLLITGENGTAFIFATYPKPFVSVPGAFVDQVVSTMFLLLIVFAIF DSRNLGVPRGLEPIVIGLLIIVISCSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFTFG NNFWWIPVVGPMIGAVLGGLIYVLFIQMHHSNPDPEVKAEPAENNLEKHELSVIM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-500 1x 500 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-100 1x 100 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
BNC740266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF488A conjugate, 0.1mg/mL
BNC881958-500 1x 500 µL

Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details