Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aquaporin-9 (AQP9)

This Recombinant Human Aquaporin-9 (AQP9) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Aquaporin-9, AQP-9, Aquaglyceroporin-9, Small solute channel 1

UniProt

O43315

Expression Region

1-295

Origin

Homo sapiens (Human)

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITI NVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATV FGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIF DSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAG NNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
BNC040806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-500 1x 500 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Golgi Complex (371-4), CF568 conjugate, 0.1mg/mL
BNC680102-100 1x 100 µL

Golgi Complex (371-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (NFL/736), CF647 conjugate, 0.1mg/mL
BNC470736-100 1x 100 µL

Neurofilament (NF-L) (NFL/736), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/991), CF405S conjugate, 0.1mg/mL
BNC040991-100 1x 100 µL

SOX10 (SOX10/991), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (8C8), CF405M conjugate, 0.1mg/mL
BNC050005-100 1x 100 µL

Bcl-2 (8C8), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details