Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Protein lplC (lplC)

This Recombinant Bacillus subtilis Protein lplC (lplC) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protein lplC

UniProt

P39129

Expression Region

1-295

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEIHTMHNTKAGRVFDVCNILFLGGVGAITILPFLYIIAGSFATEAELAQRSFFIFPKT FTLDAYKYVFSTPTFLRSMGVSIFITVVGTAVQLFFTFTMAYPLAKRHVKGRNLLLNLVI FSMLFSGGMIPTYLVVKSLGLLDTYWALILPMAINPFNLIIIKNFFQQLPRELEESAKID GCSEIGVFWRIALPLSKPVIATFALFYAVGIWNDFFHALLYINDSAKWPLQMVLRQVTIL SDLTATNGDTMQNAVPPEQGIKLAVIVIATLPILAVYPFLQKHFAKGMLIGSVKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ER81 Antibody
C10667-01 50 μL

ER81 Antibody

Sign In for Pricing
View Details
ER81 Antibody
C10667-02 100 µL

ER81 Antibody

Sign In for Pricing
View Details
OIT3 siRNA (Human)
CRJ6106-01 15 nmol

OIT3 siRNA (Human)

Sign In for Pricing
View Details
OIT3 siRNA (Human)
CRJ6106-02 30 nmol

OIT3 siRNA (Human)

Sign In for Pricing
View Details
M71-29-498 AF Systems Consumables
114801 Box of 500 Label(s)

M71-29-498 AF Systems Consumables

Sign In for Pricing
View Details
Rbbp8 (NM_001081223) Mouse Tagged ORF Clone
MR211085 10 µg

Rbbp8 (NM_001081223) Mouse Tagged ORF Clone

Sign In for Pricing
View Details