Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Phosphate transport system permease protein pstA (pstA)

This Recombinant Escherichia coli Phosphate transport system permease protein pstA (pstA) spans the amino acid sequence from region 1-296.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstA

UniProt

P07654

Expression Region

1-296

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAMVEMQTTAALAESRRKMQARRRLKNRIALTLSMATMAFGLFWLIWILMSTITRGIDGM SLALFTEMTPPPNTEGGGLANALAGSGLLILWATVFGTPLGIMAGIYLAEYGRKSWLAEV IRFINDILLSAPSIVVGLFVYTIVVAQMEHFSGWAGVIALALLQVPIVIRTTENMLKLVP YSLREAAYALGTPKWKMISAITLKASVSGIMTGILLAIARIAGETAPLLFTALSNQFWST DMMQPIANLPVTIFKFAMSPFAEWQQLAWAGVLIITLCVLLLNILARVVFAKNKHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF770 conjugate, 0.1mg/mL
BNC700160-100 1x 100 µL

CD20 (B9E9), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-500 1x 500 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF640R conjugate, 0.1mg/mL
BNC400345-100 1x 100 µL

CD4 (EDU-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF488A conjugate, 0.1mg/mL
BNC880164-500 1x 500 µL

CD28 (204.12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details