Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photorhabdus luminescens subsp. laumondii Maltose transport system permease protein malG (malG)

This Recombinant Photorhabdus luminescens subsp. laumondii Maltose transport system permease protein malG (malG) spans the amino acid sequence from region 1-296.

Product Specifications

Product Name Alternative

Maltose transport system permease protein malG

UniProt

Q7N983

Expression Region

1-296

Origin

Photorhabdus luminescens subsp. laumondii (strain TT01)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAMVQPKSQKWRLLATHLLMFTFIAMILFPLLMVITISLRPGNFATGSLIPENISWEHWK LALGYSVVSPDGRVTPPPFPVMLWLWNSVKVAFITAVGIVTLSTTCAYAFARMHFRGKST LLKGMLIFQMFPAVLSLVALYALFDRLGEYVPFIGLNTHGGVIFAYLGGIALHVWTIKGY FETIDGSLEEAAALDGATPWQAFRMVLLPLSVPILAVVFILSFIGVITEVPVASLLLRDV NNYTLAVGMQQYLNPQNYLWGDFAAAAVLSALPITIVFLVAQRWLVSGLTAGGVKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-500 1x 500 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
BNC471037-100 1x 100 µL

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/992), CF740 conjugate, 0.1mg/mL
BNC740992-500 1x 500 µL

SOX10 (SOX10/992), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/413), CF640R conjugate, 0.1mg/mL
BNC400413-500 1x 500 µL

Chromogranin A (CHGA/413), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/195), CF488A conjugate, 0.1mg/mL
BNC880195-500 1x 500 µL

CD66 (CEA) (C66/195), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-500 1x 500 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details