Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus furiosus Protein translocase subunit SecF (secF)

This Recombinant Pyrococcus furiosus Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-296.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

Q8U4B5

Expression Region

1-296

Origin

Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPEVDNVIKEKLKLLVEMDPKKMIIYPLIVFGIAIIIIIANYVMTGSFVKEGIELRGGSV ITLQGVNVSPDEIAKSIKEKTGIDVTVEKFSGVGGSGVRVYVSAGDDVNLVREALKEMFP DVEPQTVVIGPTFGEIVREQGIKAIVYAFIGMAIVVFLFFRVPVPSMTVVFSAFSDMIIA IALMNIFGIELSQATIAALLMLIGYSVDSNILLTTRLLRRKEFTVEEAYYSSLKTGFTMS TTTLGALASLWIFSTAQVIDDIASVLIFGLLADFMNTWILNAGVLRLYIAKREGKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Electrolyte Analyzer BANA-201
BANA-201 1 Unit

Electrolyte Analyzer BANA-201

Sign In for Pricing
View Details
ReadiLink™ Rapid Cy7 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*
1294-AAT 2 Labelings

ReadiLink™ Rapid Cy7 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF488A conjugate, 0.1mg/mL
BNC882616-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3193), CF405S conjugate, 0.1mg/mL
BNC043193-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3193), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Polystyrene AM COOH
H10003.5G 5 g

Polystyrene AM COOH

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details