Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Peptide transport system permease protein sapC (sapC)

This Recombinant Peptide transport system permease protein sapC (sapC) spans the amino acid sequence from region 1-296.

Product Specifications

Product Name Alternative

Peptide transport system permease protein sapC

UniProt

P0AGH7

Expression Region

1-296

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPYDSVYSEKRPPGTLRTAWRKFYSDASAMVGLYGCAGLAVLCIFGGWFAPYGIDQQFLG YQLLPPSWSRYGEVSFFLGTDDLGRDVLSRLLSGAAPTVGGAFVVTLAATICGLVLGTFA GATHGLRSAVLNHILDTLLAIPSLLLAIIVVAFAGPSLSHAMFAVWLALLPRMVRSIYSM VHDELEKEYVIAARLDGASTLNILWFAVMPNITAGLVTEITRALSMAILDIAALGFLDLG AQLPSPEWGAMLGDALELIYVAPWTVMLPGAAIMISVLLVNLLGDGVRRAIIAGVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GST3 (GSTP1) (C-term) Rabbit Polyclonal Antibody
AP23405PU-N 100 µg

GST3 (GSTP1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KCNJ5 (NM_000890) Human Over-expression Lysate
LY424464 100 µg

KCNJ5 (NM_000890) Human Over-expression Lysate

Sign In for Pricing
View Details
Human EVA1C activation kit by CRISPRa
GA111813 1 Kit

Human EVA1C activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse MBP (Myelin Basic Protein) ELISA Kit
E-EL-M0805-01 24 Tests

Mouse MBP (Myelin Basic Protein) ELISA Kit

Sign In for Pricing
View Details
Mouse MBP (Myelin Basic Protein) ELISA Kit
E-EL-M0805-02 48 Tests

Mouse MBP (Myelin Basic Protein) ELISA Kit

Sign In for Pricing
View Details
Mouse MBP (Myelin Basic Protein) ELISA Kit
E-EL-M0805-03 96 Tests

Mouse MBP (Myelin Basic Protein) ELISA Kit

Sign In for Pricing
View Details