Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized transporter ydfM (ydfM)

This Recombinant Uncharacterized transporter ydfM (ydfM) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Uncharacterized transporter ydfM

UniProt

C0SP78

Expression Region

1-297

Origin

Bacillus subtilis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASEREQISRKVALIALIANLILMAGKVFFGLVGDSEAVFADGIHSAADVVASIAVLAVI GISNKPPDQDHPFGHGKAEVISEAIVGIILVIVSVYILIEAILSFVKGPSVPQYSALFAA LISYVAKEILYRYSIKQGKKWNSKAIIAIAYDHKGDIVASLAAFIGVLLAIIGNSRGWSY LLYADAIASAIVAYLIFKISMELIRPSVDVLMEKSVDPELIEEYKAVIFQCDQVKRIDRI RAREHGHYKLLDVRLSLDHDLTIKQGHDIAREIRNEIKRQFSDVEEVLIHVNPYFEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSR1 (TRAP alpha) mouse monoclonal antibody
MB4291-01 25 µL

SSR1 (TRAP alpha) mouse monoclonal antibody

Sign In for Pricing
View Details
SSR1 (TRAP alpha) mouse monoclonal antibody
MB4291-02 100 µL

SSR1 (TRAP alpha) mouse monoclonal antibody

Sign In for Pricing
View Details
FITC Anti-Human CD40 Antibody
JOT22634F 20Tests

FITC Anti-Human CD40 Antibody

Sign In for Pricing
View Details
Anti- MOMP (C. trachomatis)
IT-502-PAN-M1-01 0.1 mg

Anti- MOMP (C. trachomatis)

Sign In for Pricing
View Details
Anti- MOMP (C. trachomatis)
IT-502-PAN-M1-02 0.5 mg

Anti- MOMP (C. trachomatis)

Sign In for Pricing
View Details
Anti-GluN2B/NR2B Glutamate Receptor (N59/36) Recombinant Chicken Chimeric mAb FL550 Conjugate
78-101-FL550 200 µL

Anti-GluN2B/NR2B Glutamate Receptor (N59/36) Recombinant Chicken Chimeric mAb FL550 Conjugate

Sign In for Pricing
View Details