Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0863 (AF_0863)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0863 (AF_0863) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0863

UniProt

O29398

Expression Region

1-297

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEMESDILRAGWEAWRRNPVTAVPFVLHGLSVIAVSIATLLSAIYAIMPELPAAILSGD FGDEAFKQMFGEFLKRCLGNIELLGVTFVFGLVIVAALAALFKAWWIKLCYDALEGKAIL STAFHHAKSLFVPLFKFELILTLLIGIAFIPLINLGLDFFRNIHMLTKEAALYYVISFMI WSAFLGIFAITIQFLFTFVPYAIVIDLKGTLSGIRRGVMVLRHNLVDTIIMWLLVGLAGM ALQVAAYPFRFFGFWGTLAGTLVAVILGWVAVMPITTCWWVELYRRRSKTLNSFPNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 (KRT18) (rKRT18/1190), CF405S conjugate, 0.1mg/mL
BNC043217-500 1x 500 µL

Cytokeratin 18 (KRT18) (rKRT18/1190), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLC1A4 Polyclonal Antibody
E-AB-12641-01 20 µL

SLC1A4 Polyclonal Antibody

Sign In for Pricing
View Details
SLC1A4 Polyclonal Antibody
E-AB-12641-02 60 µL

SLC1A4 Polyclonal Antibody

Sign In for Pricing
View Details
SLC1A4 Polyclonal Antibody
E-AB-12641-03 120 µL

SLC1A4 Polyclonal Antibody

Sign In for Pricing
View Details
SLC1A4 Polyclonal Antibody
E-AB-12641-04 200 µL

SLC1A4 Polyclonal Antibody

Sign In for Pricing
View Details
EnzyChrom™ Glucose Assay Kit II
EGL2-100 100 Tests

EnzyChrom™ Glucose Assay Kit II

Sign In for Pricing
View Details