Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0863 (AF_0863)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0863 (AF_0863) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0863

UniProt

O29398

Expression Region

1-297

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEMESDILRAGWEAWRRNPVTAVPFVLHGLSVIAVSIATLLSAIYAIMPELPAAILSGD FGDEAFKQMFGEFLKRCLGNIELLGVTFVFGLVIVAALAALFKAWWIKLCYDALEGKAIL STAFHHAKSLFVPLFKFELILTLLIGIAFIPLINLGLDFFRNIHMLTKEAALYYVISFMI WSAFLGIFAITIQFLFTFVPYAIVIDLKGTLSGIRRGVMVLRHNLVDTIIMWLLVGLAGM ALQVAAYPFRFFGFWGTLAGTLVAVILGWVAVMPITTCWWVELYRRRSKTLNSFPNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Giardia lamblia (BB1.1E5), CF594 conjugate, 0.1mg/mL
BNC940210-100 1x 100 µL

Giardia lamblia (BB1.1E5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2792), CF640R conjugate, 0.1mg/mL
BNC402792-100 1x 100 µL

Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2792), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit
E-EL-M2445-01 24 Tests

Mouse MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit

Sign In for Pricing
View Details
Mouse MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit
E-EL-M2445-02 48 Tests

Mouse MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit

Sign In for Pricing
View Details
Mouse MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit
E-EL-M2445-03 96 Tests

Mouse MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit

Sign In for Pricing
View Details
Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF488A conjugate, 0.1mg/mL
BNC881541-100 1x 100 µL

Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details