Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Frankia alni Undecaprenyl-diphosphatase 3 (uppP3)

This Recombinant Frankia alni Undecaprenyl-diphosphatase 3 (uppP3) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase 3, EC= 3.6.1.27, Bacitracin resistance protein 3, Undecaprenyl pyrophosphate phosphatase 3

UniProt

Q0RHR9

Expression Region

1-297

Origin

Frankia alni (strain ACN14a)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYFEGTVLGLVQGLTEFLPVSSSAHLRITAALAGWDDPGAAFTAVTQIGTETAVLIYFR RDIARIVRAWALSWTRREMRKDTDARVGWLVLLGTIPIGLLGVTLQDAIEGPFRDLRLIA TTLIVLGLILGGADWYASKGRPRGRHSLPRPRKTLRDLSVRDGLLYGLAQSAALIPGVSR SGATISGGLLLGYTREAAARYSFLLAMPAVLASGVFELKSIGGDREGGDGEEVSWGPTIV ATVVAFATGYAAIAWFLRYISTRSFAPFVLYRVALGLLLLALLAGGAISADAGAAAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-100 1x 100 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF740 conjugate, 0.1mg/mL
BNC740152-500 1x 500 µL

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-100 1x 100 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details