Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial carrier triple repeat protein 2 (MCART2)

This Recombinant Human Mitochondrial carrier triple repeat protein 2 (MCART2) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Mitochondrial carrier triple repeat protein 2

UniProt

Q3SY17

Expression Region

1-297

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITYPIQKVLFRQQL YGIKTRDAVLQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLRKHVRAPEFAT HGVAAVLAGTAEAIFTPLERVQTLLQNHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPIL FRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFIGGGLLGAMLGFLCFPINVVKTRLQ SQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Il12b activation kit by CRISPRa
GA202119 1 Kit

Mouse Il12b activation kit by CRISPRa

Sign In for Pricing
View Details
Tris(acetonitrile)cyclopentadienylruthenium(II) Hexafluorophosphate
TRC-T875006-250MG 250 mg

Tris(acetonitrile)cyclopentadienylruthenium(II) Hexafluorophosphate

Sign In for Pricing
View Details
2-[(4-Nitrophenyl)thio]-acetic Acid Octyl Ester
TRC-N498053-50MG 50 mg

2-[(4-Nitrophenyl)thio]-acetic Acid Octyl Ester

Sign In for Pricing
View Details
Slc41a2 Mouse Gene Knockout Kit (CRISPR)
KN516118 1 Kit

Slc41a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MTOR pSer2448 Rabbit Polyclonal Antibody
AP02480PU-N 100 µL

MTOR pSer2448 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FITC Anti-Human CD15/SSEA-1 Antibody[W6D3]
E-AB-F1142C-01 20 Tests

FITC Anti-Human CD15/SSEA-1 Antibody[W6D3]

Sign In for Pricing
View Details