Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial carrier triple repeat protein 2 (MCART2)

This Recombinant Human Mitochondrial carrier triple repeat protein 2 (MCART2) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Mitochondrial carrier triple repeat protein 2

UniProt

Q3SY17

Expression Region

1-297

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITYPIQKVLFRQQL YGIKTRDAVLQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLRKHVRAPEFAT HGVAAVLAGTAEAIFTPLERVQTLLQNHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPIL FRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFIGGGLLGAMLGFLCFPINVVKTRLQ SQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Ovary
CB511210 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
ARD1A (NAA10) Human Gene Knockout Kit (CRISPR)
KN401354 1 Kit

ARD1A (NAA10) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR4D1 Human Gene Knockout Kit (CRISPR)
KN417627 1 Kit

OR4D1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SCFD1 Mouse Monoclonal Antibody [Clone ID: OTI10D8]
CF808410 100 µg

SCFD1 Mouse Monoclonal Antibody [Clone ID: OTI10D8]

Sign In for Pricing
View Details
Vacuum Oven BOVA-7303
BOVA-7303 1 Unit

Vacuum Oven BOVA-7303

Sign In for Pricing
View Details
3-Nitro-4-hydroxyquinoline
TRC-N496210-500MG 500 mg

3-Nitro-4-hydroxyquinoline

Sign In for Pricing
View Details