Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial carrier triple repeat protein 2 (MCART2)

This Recombinant Human Mitochondrial carrier triple repeat protein 2 (MCART2) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Mitochondrial carrier triple repeat protein 2

UniProt

Q3SY17

Expression Region

1-297

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITYPIQKVLFRQQL YGIKTRDAVLQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLRKHVRAPEFAT HGVAAVLAGTAEAIFTPLERVQTLLQNHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPIL FRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFIGGGLLGAMLGFLCFPINVVKTRLQ SQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF640R conjugate, 0.1mg/mL
BNC401283-100 1x 100 µL

VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BgIII, 50 preps
FDRV1144 50 Preparations

BgIII, 50 preps

Sign In for Pricing
View Details
Blood DNA Isolation Mini Kit-100p
46380 100 Preparations

Blood DNA Isolation Mini Kit-100p

Sign In for Pricing
View Details
Tissue FFPE Sections, Cartilage
CS701014 5x 5 µm

Tissue FFPE Sections, Cartilage

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF488A conjugate, 0.1mg/mL
BNC880820-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant CD20 Antibody
RC-7057-01 50 μL

Recombinant CD20 Antibody

Sign In for Pricing
View Details