Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat ADP/ATP translocase 1 (Slc25a4)

This Recombinant Rat ADP/ATP translocase 1 (Slc25a4) spans the amino acid sequence from region 2-298.

Product Specifications

Product Name Alternative

ADP/ATP translocase 1, ADP, ATP carrier protein 1, Adenine nucleotide translocator 1, ANT 1, Solute carrier family 25 member 4

UniProt

Q05962

Expression Region

2-298

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRI PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSV QGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQ SGRKGADIMYTGTVDCWRKIAKDEGRKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-100 1x 100 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (RT-97), CF640R conjugate, 0.1mg/mL
BNC400454-100 1x 100 µL

Neurofilament (NF-H) (RT-97), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF405S conjugate, 0.1mg/mL
BNC041731-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (Lamb14), CF740 conjugate, 0.1mg/mL
BNC740860-100 1x 100 µL

Human Lambda Light Chain (Lamb14), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details