Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-34 (srd-34)

This Recombinant Serpentine receptor class delta-34 (srd-34) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-34, Protein srd-34

UniProt

Q19975

Expression Region

1-298

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVSNENANSSIMTMEANFFMCIIVVFTQVRPVNNPESSAYLFSGFCRHTHKNACFFSFD FFQLVFDASSFAIPATLFYKYTKVTNINMKNITKNQIRMILLSSYLLSLIVGVIYVITYE PDESLEVASETRKFHSTQYDFRYYADITGYQKHFWSWLATNLNMISIFVPPIMSIVFIRL IQIKLNSLKHLFTDKTAAQAKKFDLALTIQTLVPAVCVIPIYIAHLILENYDLPFLSNFE KVLYMMLSLPTAIDAFIVIVTITPYQKAFIAFFKDTFCGKKVSPAIVRRNNISAVSIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbi! anti-BCCIP Antibody, Affinity Purified
A302-196A-T 2 µg

Rabbi! anti-BCCIP Antibody, Affinity Purified

Sign In for Pricing
View Details
VapE (G-9) Alexa Fluor® 680
sc-390036 AF680 200 µg/mL

VapE (G-9) Alexa Fluor® 680

Sign In for Pricing
View Details
Human Carbonic Anhydrase-Related Protein 10 (CA10) Protein
abx692969-01 10 µg

Human Carbonic Anhydrase-Related Protein 10 (CA10) Protein

Sign In for Pricing
View Details
Human Carbonic Anhydrase-Related Protein 10 (CA10) Protein
abx692969-02 50 µg

Human Carbonic Anhydrase-Related Protein 10 (CA10) Protein

Sign In for Pricing
View Details
Tmpo (NM_001080129) Mouse Untagged Clone
MC215971 10 µg

Tmpo (NM_001080129) Mouse Untagged Clone

Sign In for Pricing
View Details
Kinesis SF Nut 1/8in PEEK Nat 10pk
CHR4027 10 / PCK

Kinesis SF Nut 1/8in PEEK Nat 10pk

Sign In for Pricing
View Details