Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-34 (srd-34)

This Recombinant Serpentine receptor class delta-34 (srd-34) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-34, Protein srd-34

UniProt

Q19975

Expression Region

1-298

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVSNENANSSIMTMEANFFMCIIVVFTQVRPVNNPESSAYLFSGFCRHTHKNACFFSFD FFQLVFDASSFAIPATLFYKYTKVTNINMKNITKNQIRMILLSSYLLSLIVGVIYVITYE PDESLEVASETRKFHSTQYDFRYYADITGYQKHFWSWLATNLNMISIFVPPIMSIVFIRL IQIKLNSLKHLFTDKTAAQAKKFDLALTIQTLVPAVCVIPIYIAHLILENYDLPFLSNFE KVLYMMLSLPTAIDAFIVIVTITPYQKAFIAFFKDTFCGKKVSPAIVRRNNISAVSIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Coagulation factor VIII related Anti-gen (FVIII-Ag) ELISA Kit
NSL0232Bo 96 Tests

Bovine Coagulation factor VIII related Anti-gen (FVIII-Ag) ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 16, Il-16 Elisa Kit
EKC39258 96 Tests

Rat Interleukin 16, Il-16 Elisa Kit

Sign In for Pricing
View Details
PHLPP1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1643402 1.0 µg DNA

PHLPP1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
NOP2 Recombinant Protein (Human)
RP041683 100 µg

NOP2 Recombinant Protein (Human)

Sign In for Pricing
View Details
FGF-12; FGF12 Protein (Human)
P515138 100 µg

FGF-12; FGF12 Protein (Human)

Sign In for Pricing
View Details
Involucrin Rabbit monoclonal antibody
orb2297880-01 25 µL

Involucrin Rabbit monoclonal antibody

Sign In for Pricing
View Details