Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitochondrial carrier triple repeat protein 1 (Mcart1)

This Recombinant Mouse Mitochondrial carrier triple repeat protein 1 (Mcart1) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Mitochondrial carrier triple repeat protein 1

UniProt

Q5HZI9

Expression Region

1-298

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDSEAHEKRPPMLTSSNQDLSPHIAGVGDMKHYLCGYCAAFNNVAITYPVQKILFRQQL YGIKTRDAVLQLRKDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSRLLHKHVSSAPEFA TRSVAALLAGTTEAILTPFERVQTLLQDHKHHDKFTNTYQAFRALRCHGIAEYYRGMVPI LFRNGFGNVLFFGLRGPIKESLPTATTYSAHLVNDFICGGVLGAVLGFLSFPINVVKARI QSQIGGPFLSLPMVFKTIWIERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ILK Adenovirus (Mouse)
24920054 250 µL

ILK Adenovirus (Mouse)

Sign In for Pricing
View Details
CD276 antibody (biotin)
MBS833341-01 0.1 mg

CD276 antibody (biotin)

Sign In for Pricing
View Details
CD276 antibody (biotin)
MBS833341-02 5x 0.1 mg

CD276 antibody (biotin)

Sign In for Pricing
View Details
RYR3 ORF Vector (Human) (pORF)
ORF031902 1.0 µg DNA

RYR3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
THOC1 Antibody
CSB-PA853419ESR1HU-01 50 μL

THOC1 Antibody

Sign In for Pricing
View Details
THOC1 Antibody
CSB-PA853419ESR1HU-02 100 µL

THOC1 Antibody

Sign In for Pricing
View Details