Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Mitochondrial carrier triple repeat protein 1 (Mcart1)

This Recombinant Rat Mitochondrial carrier triple repeat protein 1 (Mcart1) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Mitochondrial carrier triple repeat protein 1

UniProt

Q52KK3

Expression Region

1-298

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGSEAHDKRPPMLTSSNQDLSPHLADVGQIKHYFCGCCAAFNNVAITYPVQKILFRQQL YGIKTRDAILQLRKDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSRLLRKHVSNAPEFA TRSVAALLAGTTEAILTPLERVQTLLQDHKHHDKFTNTYQAFRALRCHGVAEYYRGLVPI LFRNGFSNILFFGLRGPIKEHLPTATTNSEHLVNDFICGGVLGAMLGFLSFPVNVVKARI QSQIGGPFQSLPMVFKTIWIERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
BNC740352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
BNC880257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-100 1x 100 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
BNC040226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF405S conjugate, 0.1mg/mL
BNC041118-100 1x 100 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2819R), CF568 conjugate, 0.1mg/mL
BNC682819-100 1x 100 µL

Cytokeratin 18 (KRT18) (KRT18/2819R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details