Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cation-efflux pump FieF (fieF)

This Recombinant Cation-efflux pump FieF (fieF) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Cation-efflux pump FieF

UniProt

Q8Z2W4

Expression Region

1-298

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQTYGRLVSRAAIAATAMASALLLIKIFAWWYTGSVSILAALVDSLVDIAASLTNLLVV RYSLQPADDEHTFGHGKAESLAALAQSMFISGSALFLTSIQNLIKPTPMNDPGVGIGVTV IALICTIILVTFQRWVVRKTQSQAVRADMLHYQSDVMMNGAILIALGLSWYGWHRADALF ALGIGIYILYSALRMGYEAVQSLLDRALPDAERQEIIDIVTSWPGVSGAHDLRTRQSGPT RFIQIHLEMEDNLPLVQAHFVADQVEQAILRRFPGSDVIIHQDPCSVVPREGRKFELV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-100 1x 100 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/903), CF405S conjugate, 0.1mg/mL
BNC040903-500 1x 500 µL

Cytokeratin 7 (KRT7/903), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details