Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Mitochondrial 2-oxodicarboxylate carrier (Slc25a21)

This Recombinant Rat Mitochondrial 2-oxodicarboxylate carrier (Slc25a21) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Mitochondrial 2-oxodicarboxylate carrier, Solute carrier family 25 member 21

UniProt

Q99JD3

Expression Region

1-298

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSASNVSLLHETCRQVAAGGCAGLVEICLMHPLDVVKTRFQVQRSVTDPQSYKSLRDSFQ VIFRTEGLFGFYKGIIPPILAETPKRAVKFSTFELYKKFLGYMSLSPGLTFPIAGLGSGL TEAVVVNPFEVVKVGLQVNRNMFTEQPSTFAYARQIIKKEGWGFQGLNKGFTATLGRHGI FNMTYFGFYYNVKDNIPSSKDPTLEFLRKFGIGFVSGTVGSVFNIPFDVAKSRIQGPQPV PGEIKYRGCFKTMETVYREEGILALYKGLLPKVMRLGPGGGVMLLVYEYTYAWLQENW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-500 1x 500 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin-A (NAPSA/1239), CF594 conjugate, 0.1mg/mL
BNC941239-100 1x 100 µL

Napsin-A (NAPSA/1239), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR484), CF405S conjugate, 0.1mg/mL
BNC040484-500 1x 500 µL

Progesterone Receptor (PR484), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-x (BX006 + 2H12), CF594 conjugate, 0.1mg/mL
BNC940752-500 1x 500 µL

Bcl-x (BX006 + 2H12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details