Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

This Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit E, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E

UniProt

A4FVW5

Expression Region

1-299

Origin

Methanococcus maripaludis (strain C5 / ATCC BAA-1333)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTLISLGALALAGAAATVSGCAEDLESDVGSQSNPNSQVQLGPQMGNIHRYFNKAISG EPVSYGLYVAVAGTIAWALINAGLNAVLAIIVGSGVAAVVHGAYSVSAFLGRTVGQSKKF GQPVYMDVLTSHIGPIVGHGFIAVFTMTLAAYLATTALGNPFPLPLVALIFGITVGAIGS STGDVHYGAEREYQKYPFGGGIPVANQGDIDIYAEYGVRNGLDSSYFCSRFGGPLTGLCF GLIIFLDGWRSILGNIIGGDLVTKTSIALLVGLLVVAVAAGINRKLEVYARNKYGPYRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tpmt siRNA Oligos set (Rat)
47379176 3x 5 nmol

Tpmt siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Glutathione Synthetase Recombinant Rabbit mAb
E43S45439 100 µL

Glutathione Synthetase Recombinant Rabbit mAb

Sign In for Pricing
View Details
Gm6934 3'UTR GFP Stable Cell Line
TU158508 1.0 mL

Gm6934 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 Bifunctional polymyxin resistance protein ArnA (arnA), partial
MBS1138268 Inquire

Recombinant Salmonella enteritidis PT4 Bifunctional polymyxin resistance protein ArnA (arnA), partial

Sign In for Pricing
View Details
GLRX5 Antibody (Center)
E45M04794G-1 100 µL

GLRX5 Antibody (Center)

Sign In for Pricing
View Details
Col27a1 ORF Vector (Rat) (pORF)
ORF065266 1.0 µg DNA

Col27a1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details