Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

This Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit E, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E

UniProt

A6VHE8

Expression Region

1-299

Origin

Methanococcus maripaludis (strain C7 / ATCC BAA-1331)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTLISLGALALAGAAATVSGCAEDLESDVGSQSNPNSQVQLGPQMGNIHRYFNKAISG EPVSYGLYVAVAGTIAWALINAGLNAVLAIIVGSGVAAIVHGAYSVSAFLGRIVGQSKKF GQPVYMDVLTSHIGPIVGHGFIAVFTMTLAAYLATTALGNPFPLPLVALIFGITVGAIGS STGDVHYGAEREYQKYPFGGGIPVANQGDIDIYAEYGVRNGLDSSYFCSRFGGPLTGLCF GLIIFLDGWRSILGNIVGGDLVTKTSIALLVGLLVVAVAAVINRKLEVYARNKYGPYRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-CLPTMl Antibody, Affinity Purified
A304-388A 100 µg

Rabbit anti-CLPTMl Antibody, Affinity Purified

Sign In for Pricing
View Details
LLGL1 Antibody, HRP conjugated
A55740-100UL 100 µL

LLGL1 Antibody, HRP conjugated

Sign In for Pricing
View Details
CLEC1A
CSB-CL843319HU 10 μg Plasmid + 200 μL Glycerol

CLEC1A

Sign In for Pricing
View Details
Recombinant Human DNA-directed RNA polymerase III subunit RPC1 Protein, His-SUMO, E.coli-200ug
QP6511-ec-200ug 200ug

Recombinant Human DNA-directed RNA polymerase III subunit RPC1 Protein, His-SUMO, E.coli-200ug

Sign In for Pricing
View Details
Lysophospholipase 1 Rabbit Monoclonal Antibody
E56G1829 100 µL

Lysophospholipase 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ENPP2 (NM_001040092) Human Over-expression Lysate
LC421669 20 µg

ENPP2 (NM_001040092) Human Over-expression Lysate

Sign In for Pricing
View Details