Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Borrelia burgdorferi Protein translocase subunit SecF (secF)

This Recombinant Borrelia burgdorferi Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

O51597

Expression Region

1-299

Origin

Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRVINFSKYGSNVLIVSAVLILVGLIYTFFYHGGYNWGIDFSSRVNINLSIEKSNIKEN EIKKIFSPIYKTLDVNSIFSPDQNKSEFSIMVKSDVIDYAFKTEVQKTILDKLKETFDAN IEVLDSYFIDSSFSSTLRIRSIFLVLGTFILILIYITLRFKLSYAIASILSIFHDIFFIV AFLGVFRIEINSYIIVAILTIIGYSLNDTIIIFDRIRDNVKRLTDNTFLNVLNISISQTL SRTVLTSVTTFVAVFSIYVFTEGSIKDFSLVFMVGVIVGTYSSVFIASPILLNLYKKIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
BNC551037-500 1x 500 µL

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
BNC041037-100 1x 100 µL

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
BNC680270-500 1x 500 µL

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (PTH/1174), CF640R conjugate, 0.1mg/mL
BNC401174-500 1x 500 µL

PTH / Parathyroid Hormone (N-Terminal) (PTH/1174), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL2-like 2 (CPTC-BCL2L2-2), CF740 conjugate, 0.1mg/mL
BNC742265-500 1x 500 µL

BCL2-like 2 (CPTC-BCL2L2-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF405S conjugate, 0.1mg/mL
BNC042053-500 1x 500 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details