Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0779 (MJ0779)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0779 (MJ0779) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0779

UniProt

Q58189

Expression Region

1-299

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPKYLTTLYKRTIKRNIILFKKLGKDFDEKKFILLLIIIAAIPLLISYYLHLTLKSMIIF VVIYVGAALFIPSILYENKIETLENNIPQALYIMILALESGRSINEALLEVVKSNIKEVS DIFRKVLYLMENQKLSFEESMTIVSNLYDSKVLRMLARIMIENRKYGGDLSDSLKILAKT LEDFKMYKRQLLSVTASGLAIGFIILCGVIPAVAALLGAYLIAVSGMLSGVAPIPPVKPE DISKGFEIVQMGTAIIGALFAIPIFGLKIGRMFLISAVTMTIGVLAYYTILKFAPGIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSH antibody
10-T15B 1 mg

TSH antibody

Sign In for Pricing
View Details
N-Acetyl-D-mannosamine-13C,d3
TRC-A186208-1MG 1 mg

N-Acetyl-D-mannosamine-13C,d3

Sign In for Pricing
View Details
NEBNext Ultra II DNA PCR-Free Library Prep Kit for Illumina
NEB E7410L 96 Reactions

NEBNext Ultra II DNA PCR-Free Library Prep Kit for Illumina

Sign In for Pricing
View Details
Human Polyamine Oxidase (PAOX) ELISA Kit
DL-PAOX-Hu-01 48 Tests

Human Polyamine Oxidase (PAOX) ELISA Kit

Sign In for Pricing
View Details
Human Polyamine Oxidase (PAOX) ELISA Kit
DL-PAOX-Hu-02 96 Tests

Human Polyamine Oxidase (PAOX) ELISA Kit

Sign In for Pricing
View Details
NSDHL Peptide
MBS3233426-01 0.1 mg

NSDHL Peptide

Sign In for Pricing
View Details