Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

This Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit E, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E

UniProt

Q6LWZ4

Expression Region

1-299

Origin

Methanococcus maripaludis (strain S2 / LL)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTLISLGALALAGAAATVSGCAEDLESDVGSQSNPNSQVQLGPQMGNIHRYFNKAISG EPVSYGLYVAVAGTIAWALINAGLNVVLAIIVGAGVAAIVHGAYSVSAFLGRTVGQSKKF GQPVYMDVLTSHIGPIVGHGFIAVFTMTLAAYLATTALGNPFPLPLVSLIFGITVGAIGS STGDVHYGAEREYQKYPFGGGIPVANQGDIDIYAEYGVRNGLDSSYFCSRFGGPLTGLCF GLIIFLDGWRSILGNIIGGDLVTKTSIALLVGLLVVAVAAVINRKLEVYARNKYGPYRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB42 Protein Vector (Human) (pPB-N-His)
PV144275 500 ng

ZBTB42 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
SSNA1 Recombinant Protein (Human)
RP030166 100 µg

SSNA1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Decorin (DCN) (NM_133505) Human Tagged ORF Clone Lentiviral Particle
RC212053L4V 200 µL

Decorin (DCN) (NM_133505) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ETV4 (ETS Translocation Variant 4, E1AF, PEA3, E1A-F, PEAS3) (MaxLight 405)
MBS6416458-01 0.1 mL

ETV4 (ETS Translocation Variant 4, E1AF, PEA3, E1A-F, PEAS3) (MaxLight 405)

Sign In for Pricing
View Details
ETV4 (ETS Translocation Variant 4, E1AF, PEA3, E1A-F, PEAS3) (MaxLight 405)
MBS6416458-02 5x 0.1 mL

ETV4 (ETS Translocation Variant 4, E1AF, PEA3, E1A-F, PEAS3) (MaxLight 405)

Sign In for Pricing
View Details
Cross-linked dextran G 25, fine
HY-148140C 1 Each

Cross-linked dextran G 25, fine

Sign In for Pricing
View Details