Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Mitochondrial 2-oxodicarboxylate carrier (SLC25A21)

This Recombinant Bovine Mitochondrial 2-oxodicarboxylate carrier (SLC25A21) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Mitochondrial 2-oxodicarboxylate carrier, Solute carrier family 25 member 21

UniProt

A0JN87

Expression Region

1-299

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAKPSVGFVNEASRQILAGGSAGLVEICLMHPLDVVKTRFQIQRCTTDPNSYKSLGDSF RMIFRTEGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAVAGLGSG LTEAIVVNPFEVVKVGLQANRNRFTEQPSTMSYARHIIKKEGLGLGGLNKGFTATLGRHG VFNMVYFGFYFNVKNIIPVNKDPTLEFLRKFGIGLLSGTIASVINIPFDVAKSRIQGPQP VPGEIKYKTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-100 1x 100 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL
BNC940437-500 1x 500 µL

CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF405S conjugate, 0.1mg/mL
BNC041448-500 1x 500 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD64 (10.1), CF568 conjugate, 0.1mg/mL
BNC682846-100 1x 100 µL

CD64 (10.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/799), CF740 conjugate, 0.1mg/mL
BNC740799-100 1x 100 µL

Cytokeratin 19 (KRT19/799), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details