Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dipeptide transport system permease protein dppC (dppC)

This Recombinant Dipeptide transport system permease protein dppC (dppC) spans the amino acid sequence from region 1-300.

Product Specifications

Product Name Alternative

Dipeptide transport system permease protein dppC

UniProt

P0AEG3

Expression Region

1-300

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQVTENKVISAPVPMTPLQEFWHYFKRNKGAVVGLVYVVIVLFIAIFANWIAPYNPAEQ FRDALLAPPAWQEGGSMAHLLGTDDVGRDVLSRLMYGARLSLLVGCLVVVLSLIMGVILG LIAGYFGGLVDNIIMRVVDIMLALPSLLLALVLVAIFGPSIGNAALALTFVALPHYVRLT RAAVLVEVNRDYVTASRVAGAGAMRQMFINIFPNCLAPLIVQASLGFSNAILDMAALGFL GMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAILLTVLAFNLMGDGLRDALDPKLKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2B Rabbit Polyclonal Antibody
HA500381 100 µL

Histone H2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PSMA (FOLH1) Mouse Monoclonal Antibody [Clone ID: OTI6B10]
CF814043 100 µg

PSMA (FOLH1) Mouse Monoclonal Antibody [Clone ID: OTI6B10]

Sign In for Pricing
View Details
RNF168 Recombinant Rabbit Monoclonal Antibody [PSH07-38]
HA722826 100 µL

RNF168 Recombinant Rabbit Monoclonal Antibody [PSH07-38]

Sign In for Pricing
View Details
Biotin Conjugated Limulus polyphemus Lectin (Horseshoe Crab) -LPA-
BA-1501-1 1 mg

Biotin Conjugated Limulus polyphemus Lectin (Horseshoe Crab) -LPA-

Sign In for Pricing
View Details
Rfesd Mouse Gene Knockout Kit (CRISPR)
KN514693 1 Kit

Rfesd Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Boc-L-azetidine-2-carboxylic Acid
TRC-B624500-2G 2 g

N-Boc-L-azetidine-2-carboxylic Acid

Sign In for Pricing
View Details